The URL can be used to link to this page

Home My WebLink About14-4948 Supreme Court o_f.Pennsylvania on Pleas T 11tiE S'TA�1 P� For Prothonotary Use Only. CroVelDocket No: w4gv aivilTerm CUMB RIt County The in formation collected on this form is used solely for court administration purposes. This fonn does not supplement or replace thefiling and service ofpleadings or other a ers as required by law or rules of court. S Commencement of Action: E ® Complaint ❑ Writ of Summons ❑Petition C ❑Transfer from Another Jurisdiction ❑Declaration of Taking Lead Plaintiffs Name: Lead Defendant's Namc: T I PORTFOLIO REC'OVERYASSOCIATES,LLC NICOLECARNEY I t O _ Are money damages requested?® Yes O No Dollar Amount Requested: X within arbitration limits N (Check one) outside arbitration limits A Is this a Class Action Suit? ❑Yes ®No Is this an AMJAppeal? ❑Yes ®No Name of PlaintifflAppellant's Attorney:Robert N.Polas,Jr./Carrie Brown/Mark R.Garvey ❑ Check here if you have no attorney(are a Self-Represented[Pro Sel Litigant) Nature of the Case: Place an "X" to the left of the ONE case category that most accurately describes your PRIMARY CASE. if you are making more than one type of claim, check the one that you consider most important. TORT(do not include Mass Tort) CONTRACT(do not include Judgments) CIVIL APPEALS ❑ Intentional ❑ Buyer Plaintiff Administrative Agencies ❑ Malicious Prosecution Q Board of Assessment ❑ Motor Vehicle ❑ Debt Collection:Credit Card ❑ Board of Elections ❑ Nuisance ® Debt Collection:Other Q Dept.of Transportation ❑ Premises Liability ❑ Statutory Appeal:Other S ❑ Product Liabiiity(does not include E mass tort) ❑ En ployment Dispute: ❑ Slander/Lbel/Defimation Discrirrim ion ❑ Zoning Board C Q Other: Q Employment Dispute:Other ❑ Other: TR I ❑ Other: 0 j MASS TORT N ❑ Asbestos ❑ Tobacco REAL PROPERTY MISCELLANEOUS ❑ Toxic Tort-DES ❑ B ❑ Toxic Tort-Implant Ejectment El Common Law/Statutory Arbitration ❑ Toxic Waste [3 Eminent Domain/Conderntnation ❑ Declaratory Judgment ❑ Other: E] Ground Rent ❑ Mandamus ❑ Landlord/Tenant Dispute ❑ Non-Domestic Relations i Q Mortgage Foreclosure:Residential Restraining Order ❑ Mortgage Foreclosure:Commercial ❑ Quo Wananto ❑ Partition ❑ Replevin PROFESSIONAL LIABILITY ❑ Quiet Title Q Other: ❑ Dental ❑ Other: ❑ Legal ❑ Medical Q Other Professional 14-50219 Robert N. Polas, Jr., Esquire PA Bar#201259 Carrie Brown, Esquire PA Bar# 94055 R E C D-vr-C E Mark R. Garvey, Esquire PA Bar# 312686 PD"-)THr ;;r n j Portfolio Recovery Associates, LLC 120 Corporate Blvd y iai r T4 Norfolk, VA 23502 TELE: 1-866-428-8102 CT'IBERLANO C UN i Y FAX:(757) 518-0860 P E iN N S Y LVA N 1 A Attorneys for Plaintiff IN THE COURT OF COMMON PLEAS OF CUMBERLAND COUNTY, PA CIVIL ACTION-LAW PORTFOLIO RECOVERY ASSOCIATES, LLC _ 120 CORPORATE BLVD _ dT-01 /- NORFOLK, VA 23502 No. l I Plaintiff, V. NICOLE CARNEY 9 GRINNEL DR CAMP HILL PA 17011 Defendant. NOTICE You have been sued in Court. If you wish to defend against the claims set forth in the following pages, you must take action withing twenty(20) days after this Complaint and Notice are served, by entering a written appearance, personally or by an attorney, and filing in writing with the Court your defenses or objections to the claims set forth against you. You are warned that if you fail to do so, the case may proceed without you and a judgment may be entered against you by the Court without further notice of any money claimed or any other claim or relief requested by the Plaintiff. You may lose money or property rights important to you. YOU SHOULD TAKE THIS PAPER TO YOUR LAWYER AT ONCE. IF YOU DO NOT HAVE A LAWYER, OR CANNOT AFFORD ONE, GO TO OR TELEPHONE THE OFFICE SET FORTH BELOW TO FIND OUT WHERE YOU CAN GET HELP. THIS OFFICE CAN PROVIDE YOU WITH INFORMATION ABOUT HIRINNG A LAWYER. IF YOU CANNOT AFFORD TO HIRE A LAWYER, THIS OFFICE MAY BE ABLE TO PROVIDE YOU WITH INFORMATION ABOUT AGENCIES THAT MAY OFFER LEGAL SERVICES TO ELIGIBLE PERSONS AT A REDUCED FEE OR NO FEE. Lawyer Referral Service - CUMBERLAND County Bar Association Cumberland County Bar Association 32 South Bedford Street Carlisle, PA 17013 ( S. 75 AD (717) 249-3166 534(p0q J,6q?8�7 14-50219 31 of l� This communication is from a debt collector and is an attempt to collect a debt. Any information obtained will be used for that purpose. Robert N. Polas, Jr., Esquire PA Bar#201259 Carrie Brown, Esquire PA Bar#94055 Mark R. Garvey, Esquire PA Bar# 312686 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 TELE: 1-866-428-8102 FAX: (757) 518-0860 Attorneys for Plaintiff IN THE COURT OF COMMON PLEAS OF CUMBERLAND COUNTY, PA CIVIL ACTION -LAW PORTFOLIO RECOVERY ASSOCIATES, LLC 120 CORPORATE BLVD NORFOLK, VA 23502 Demandante, No. V. NICOLE CARNEY 9 GRINNEL DR CAMP HILL PA 17011 Demandado. NOTICIA USTED HA SIDO DEMANDADO/ A EN LA CORTE. Si usted desea defender conta la demanda puestas en las siguientes paginas, usted tienen que tomar accion dentro veinte (20) dias despues que esta Demanda y Aviso es servido, con entrando por escrito una aparencia personalmente o por un abogado y archivando por escrito con la Corte sus defensas o obejciones a las demandas puestas en esta contra usted. Usted es advertido que si falla de hacerlo el caso puede proceder sin usted y un juzgamiento puede ser entrado conta usted por la Corte sin mas aviso por cualquier dinero reclamdo en la Demanda o por cualquier otro reclamo o alivio solicitado por Demandante. Usted puede perder dinero o propiedad o otros derechos importante para usted. LISTED DEBE LLEVAR ESTE PAPEL A SU ABOGADO ENSGUIDA. SI USTED NO TIENE UN ABOGADO,VAYA O LAMME POR TELEFONO LA OFICINA FIJADA AQUI ABAJO. ESTA OFICINA PUEDE PROVEERE CON INFORMACION DE COMO CONSEGUIR UN ABOGADO. SI USED NO PUEDE PAGARLE A UN ABOGADO, ESTA OFICINA PUEDE PROVEERE INFORMACION ACERCA AGENCIAS. QUE PEUDAN OFRECER SERVICIOS LEGAL A PERSONAS ELGIBLE UN HONORARIO REDUCIDO O GRATIS. Lawyer Referral Service - CUMBERLAND County Bar Association Cumberland County Bar Association 32 South Bedford Street Carlisle, PA 17013 (717) 249-3166 14-50219 Esta conmicacion es de un cobrador de deudas y es un intent do cobras una deuda. Cual.quie.r infromacion.sera utilizada para ese proposito. Robert N. Polas, Jr., Esquire PA Bar#201259 Carrie Brown, Esquire PA Bar# 94055 Mark R. Garvey, Esquire PA Bar# 312686 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 TELE: 1-866-428-8102 FAX: (757) 518-0860 r Attorneys for Plaintiff IN THE COURT OF COMMON PLEAS OF CUMBERLAND COUNTY, PA CIVIL ACTION- LAW PORTFOLIO RECOVERY ASSOCIATES, LLC 120 CORPORATE BLVD NORFOLK, VA 23502 Plaintiff, No. V. NICOLE CARNEY ; 9 GRINNEL DR ; CAMP HILL PA 17011 Defendant. COMPLAINT 1. Plaintiff, Portfolio Recovery Associates, LLC is a Delaware Limited Liability Company with offices located at 120 Corporate Blvd, Norfolk, VA 23502. 2. Defendant,NICOLE CARNEY, is an adult individual with last known address of 9 GRINNEL DR, CAMP HILL PA 1701 L 3. It is averred that Defendant was indebted to GE CAPITAL RETAIL BANK/HOME DESIGN - NHFA on July 29, 2011 with account number ************7330(hereafter referred to as "Account"). 4. By using the Account, Defendant agreed to repay any incurred balances and/or charges made to the Account pursuant to the terms and conditions governing said Account. Failure to pay Defendant's incurred charges on the Account is considered a default. 5. At all relevant times material hereto, Defendant has used said Account for the purchase of products, goods and/or for obtaining services. This communication is from a debt collector and is an attempt to collect a debt. Any information obtained will be used for that purpose. 6. Defendant was provided with copies of the Statements of Account showing all debits and credits for transactions on the aforementioned Account to which there was no bonafide objection by Defendant. A copy of the charge off statement is attached hereto and collectively marked as Exhibit "A." 7. Defendant was in default with respect to that debt for failure to make the required payments on the Account. The last payment made on this Account was on March 11, 2013. 8. Plaintiff is the purchaser, assignee and/or successor in interest GE CAPITAL RETAIL BANK/ HOME DESIGN -NHFA and Plaintiff is now the holder of the Account. A true and correct copy of the Plaintiff s Bill of Sale is attached hereto and collectively marked as Exhibit "A." 9. As of the date within Complaint, the remaining balance due, owing and unpaid on Defendant's Account, as a result of Defendant and/or any authorized user's use of said Account is in the sum of$1,909.16. 10. Despite reasonable and repeated demands for payment. Defendant has refused and continues to refuse to pay all sums due and owing on the aforementioned Account, all to the damage and detriment of the Plaintiff. 11. The amount in controversy is within the jurisdictional amount requiring compulsory arbitration. WHEREFORE, Plaintiff respectfully requests this Honorable court enter Judgment in favor of Plaintiff and against Defendant, NICOLE CARNEY , in the amount of$1,909.16, plus cos of th' action and any other relief as the Court deems just a reas Carrie A. Brown, Esquire, #94055 Robert N. Polas, Jr., Esquire, #201259 Mark R. Garvey, Esquire, # 312686 Attorneys for Plaintiff 14-50219 This communication is from a debt collector and is an attempt to collect a debt. Any information.obtained will be used for that purpose. VERIFICATION The undersigned Custodian of Records for Portfolio Recovery Associates, LLC, CMUna Patterson hereby states that he/she is authorized to take this verification on behalf of said Plaintiff in the within action and verifies that the statements made in the foregoing Complaint are true and correct to the best of his/her knowledge, information, and belief,based upon information provided by the Plaintiff. The undersigned understands that false statements herein are made subject to the penalties of 18 Pa. C.S. Section 4904, relating to unsworn falsification to authorities. JUL 09 2014 Date: BY Cdstina Patterson Custodian of Records 14-50219 This communication is from a debt collector and is an attempt to collect a debt. Any information obtained will be used for that purpose. XHIBIT A This communication is from a debt collector and is an attempt to collect a debt. Any information obtained will be used for that purpose. ................................... 33o4335617:. : .... GE'CAplTAlRETAlCBAN 5z: : GffsTo� - -2013 • 11;....... 12a,m. OB 21 GE Capitcd BILL or SALE PRA PSCC Fresh—July 2013: For value received and in.f tither:Go ideration of the mutual covenants and conditions.sei forth in.the: Forward:FlowReceivables.Purchase Agreezt► ent e'«A.... d. : .. . me ated o this:9 d between General:Electric:Capital Corporation,GE Cap Retail Bank;GENIB Lendin ,:Inc,f Moy= Services,L:L,C.�I2FS Holding;I,.L.C:,and GEM:Holdin 1rL.0 01:3.by.and': . no Credit ..Recon gr. .(collectively"Seller"�and portfolio ery Associates,LLC(`_Buyer"};Sellet ltereby traiisfers,.sells,conveys;grants,and delivers to$4er,:its siiccessors:and:as5i s,wit&out irecourse.exc t aS set forth in the.Agreeirient;.to:the exterit:of itsownersliip;:the: Receivables;as set forth in the.Notification Files(ss:defined.in the:Agreemenf :delivere July 22;20.13,and.as.further described in the Agreement: ), y.Seller to Buyer en' : . . Reta' GE Capital: t1 Barik •. �. mices,L.L.C. ::.. M . onogram:Credit Se By.,. : . Ken w0j.Wojcik . .. . tt .. AY n . ome i F Ken Wojcik Y 'Title: EVp.Collecfions.&Recovery :.. . . Date:, t�..l� ... : . Date:..: . RFHol ding,L.L.C: ..: General Electric Capital..Corporatian. :. By: omey in Fac Keri Wojcik . Attomey.infa en:Wojcik :: . . . :.. .. . ... Bate: Daze:_ 'd$. f'C'=( , . . .:. EM Holding,.L.L.0...:. G .. Hol: : MB Lend'. :Inc . .:... . tn8,. ey in F Attorn Ken Wojcik :. Attorney:in Fact en Wojcik Date: r Date:: .:: Portfolio Recovery Associates:.LCG'. . . . ... . . . . Title: HOME DESIGN-NAHFA/GECR6 Cardholder Name: UIQUIC -EY GE Mone Account Number: 7330 y Statement Closing Date: 06/10/2013 Summary of Account Activity Payment Information Previous Balance $1,874.16 New Balance $0.00 + New Purchases $0.00 Total Minimum Payment Due $547.00 Payments $0.00 Payment Due Date 0611212013 +/- Credits,Fees&Adjustments(net) $1,874.16- PAYMENT DUE BY 5 P.M.EASTERN ON THE DUE DATE. +/- Interest Charge net $0.00 We may convert your payment into an electronic debit. See New Balance $0.00 reverse side. Credit Limit $3,000.00 Available Credit $0.00 Late Payment Warning:If we do not receive your Total Days in Billing Period 28 Minimum Payment Due by the Payment Due Date listed above, you may have to pay a late fee up to$35.00. Pay online for free at:gogecapital.com For GE Capital Retail Bank customer service or to report your card lost or stolen,call 1-866396-8264. Best times to call are Wednesday-Friday. Transaction Summary Tran Date Post Date Reference Number Description Amount 06/10/2013 06110/2013 F9073005100999990 CHARGE OFF ACCOUNT-PRINCIPALS $1,047.59 CR 06110/2013 06110/2013 F9073005100999990 CHARGE OFF ACCOUNT'FINANCE $861.57 CR CHARGES' FEES 06/05/2013 06/05/2013 LATE FEE $35.00 TOTAL FEES FOR THIS PERIOD $35.00 INTEREST CHARGED 06/10/2013 06/10/2013 INTEREST CHARGE ON PURCHASES $0.00 TOTAL INTEREST FOR THIS PERIOD $0.00 2013 Totals Year-to-Date Total Fees Charged in 2013 $175.00 Total Interest Charged in 2013 $217.51 Total Interest Paid in 2013 $5.16 Interest Charge Calculation Expiration Date Annual Balance Subject to Interest Charge Type of Balance Percentage Interest Rate Rata(APR) Purchases NA 29.99% $0.00 $0.00 NOTICE: See reverse side and additional pages(if any)for important information concerning your account. 5302 Cxl1 1 3 10 130610 'L D PAGE 1 of 1 9073 3100 XP60 OIEJ5302 Pay online at gogewpital.can or enclose this coupon with your check.Please use blue or black ink. - Total Minimum Past Due Payment Ne I Account Number Payment Due Amount Due Date Balance $547.00 $0.00 06/12/2013 $0.00 7330 Payment Enclosed: s ❑❑❑❑ ❑■ ❑❑ ❑ New address or e-mail? Payment due includes$0.00 past due.Please pay the past due amount PROMPTLY. Check the box at left and print changes on back NICOLE L CARNEY 9 GRINNEL DR CAMP HILL PA 17011-7716 Make Payment to: GE CAPITAL RETAIL BANK PO BOX 960061 ORLANDO,FL 32896-0061 Customer Sbrv/ca1Questlons:For account inlormatlog please cab the td/free number on the front of this statement.Unless your name Is fated on this statement,your access to information on the account may be limited You may also mail questions(but not payments)to.,P.0&!x981127,BPaso,7X79998-1127.Pkaselndudeyavaccountnumberon any correspondence yousend nous. Payments:Send payments to the address listed on the remittance coupon portion of this statement or pay online at LA .aemoneycom. Aernig Payments:paymentscannot be made fn person,mall payments to.GEMoney Sank 140 Wekha SpdngslbaQ Longwood! Notice:See below foryourBlling Rghtsar)dotherhmportant information.Tekepimingabout blllirgerrorswIDrtot preserve yourifghts underfederallaw.To preserve yourrfghM please wrfte toourBAirglnqulufesA"ess,p,C BOX981438,BPasq 7X79998-1438. Purdtasestetumsandpaymentsmadejustpr(ortobilringdate may not appearuntilnextmonthsstatement.We reserve the right to obtain payment electronkaly for arty check or other instrument that you send to us by initiating an ACH(electronic)debit in the amount of your check orlrstrument to your account.!bur dheckorinsunment will not be returned to you by us or yourbank)bur bank account maybe debited as ea*as the same day we receive your payment.You may choose not to have your payment co/fected electronically by sending your payment(with the remittance coupon),in your own envelope-not the enclosed remittance envelope,addressedto:POBox 530960,Atlanta,6430353-0960andnotthepayment address What To Do if low Think You Rnd AMistake on)bur Statement ff you think there Is an error on your statement,write to us at.GE Money Bank,PC Bax 981438,B Faso,7X79998-1438.In your lettergive us the following information:.Account information:)bur name andaccountnumber.Ddlaramoret:7lte dollarammiM ofthesuspededenor.DesWptlon ofprobfem:Nyou thlnktheretsan enoronyourbi14dLsr bewhatyoubefieveiswrongandwhyyoube&veitisa mistake.You must contact us within 60 daysafterthe error appeared on your statement.YOU must notify us of arty potential errors/n wnting.You may call us,but I/you do we are not required to Investigate any potential errors and you may have to pay the amount in question.While we Investigate whether or not there hasbeen an ens;the following are true: .We cannot try to cdled the amount in question orrepolt you as delinquenton that amount..The charge in question may remain on yourstatement andwe may continue to charge you interest on that amount.But,IF we determine that we made a mistake,you will not have to pay the amount In question or any/Merest or other fees related to that amount..While you do not have to pay the amount In questiwt,you are responsible for the remainderof yon balance..We can applyanyunpaidamomtagakhst yourcredt frmit. Your Rghts ifYbuAre Dissatisfied With Your Credit Card Purchases:ffyouare dssathfled with thegoods orservioes that you have purdnased wth yoencredt cared andyouhave trkdingttod faith toconect the problem with the merchant,youmayhave the rlghtnot to pay the remaining amount dere on the purchase.To use thlsrfgM,a8of the fdlowfigmusbe true:!)The purchase must have been made In yornhome state orwKMn 100 miles of yourcrmpnt mailing address and the purchase price must have been more than$50. Qlfote:Neither of these are necessary ffyour pumltase was based on an advertisement we malted to you,or/f we own the company that soleiyou the goods orservfces)2)Ybu must have used your crick caul for the purchase.Rurchases made with cash advances Irom anA7Morwitha chedkthat accessesyauraedt cardattnuntdo not qualffy.3)Ybumusnot yet have fully pa id for the purchase. ffall of the criteria oboe are met and you are sttl dssatLdiad wkh the purdwse,oorttad usin writing at:PO.Box 981438,8 Paso,7X 799981438.lNhfk welnves/gate,the same nulesappy to the dapufedamount as dlscrtssedabove.After we finish onMvesUgatkx we w(8te0youourdecl5lon.At that print,ffwe thlnkyou owe an amountandyouebtatpay we may report you asdefenquerd- Information About payments:You may pay more than the Total Minimum Payment at any time.Paymentsmoeled afterliM RN nism=981438, y w186eaedltedasofthe next day.aedrt to youraccountmaybe delayedup tolivedaysffpayment(a)isnot receivedat adrkess Qt)lsnot made In U.S do8arsebawn ora U.S firtanc�al irtstltntionkcatedfn the U.S,(c)isnot acconnpaniedby the eiporn attached fo your staterneM,(�mntaksmore than cure payment OI remfttan ee coupon,(e)is rat received In the hvebpe provided or ittdttdes staples paper dips tape a forted dtedc a correspondence ofarry type.C ndtlonarty en oommunicatkxu oahoerning daputed amoutrts Inthudng any check or other payment instrument that.,payment oonstRntes'payment!n lull"oils tendered as fu8satk(adkon o/a disputed amount,or#9Is tendered with nsor)imitattons('DLsputedPayments'j mustbemai�ctord�theredtousatPCBox981438,BPasg7X799981438. Credits to Your Account:An amount shown with a CR next to the amount Is a creat or credit balance unless otherwise Indicated Or edits wl8be applied to yourprevfwnbalaraeimmedlate/yupon moeipt,but will not satisfyanyrequhedpayment that maybe due. Telephoto Monitoring:For quality cattml purposes,you permit us to Eaten to or record telephone calls between you and us. Credit Reports andAcco unt Information:ffyoubelieve that we may havereportedinaccurateInformation about you to consumer. reporting agency,please contact us atP.0 Box 981439,BPasq 7X79998.1439.in doing so,please Identify the Ina ecruate Information andtefluswhy youbelieveitlshroonect.ffyouhavea copyofthe red treport that Incudesthe Inaocurdteinformat/on pleaseInclude a copy o1 that report.We may report intormation about youraocount to credit bureaus Late payment;missed payment;or other dL faults on youraoeountma y be reflected in your credit report. Variable I?ate Information:Karry of yourAPR,are variable,that APRw11l vary with the market based on the Rime Rate. HowLong WfilthePenaltyfbteApp/y?ffyourAPftateittcreasedbecause youmadea late payment,theFena tyAPRwiBapptyunt8 youmakesbroonsecrtiveminfmum paymentswhendue. How We Calculatelnterest:Weuseamethodcalled'tfallybalarce Dudngbimrgcydesinwhkhintemstischargedforeachbalance type on your account we figure the Interest charge on your account by applying the periodic rate to the'dally balance"of your account far each day in the bllrng cycle.A separate daft'balance w)8 be calculated for tike following balance types,as applicable: purdeaseA balance Varsfers,cash advances and direr balances that are subject to different Interest rates,flans or special prornotkxs.Rrst,we determine the'dailybalarae'.'To determine the dailybalance,we take thebeginnirg balance each day,addany new charges and fees posted that day,and subtract any payments and credits posted that day.This gives us the daffy balance. Second,we calculate the amount ofinterest charged To do this,we multipy the applicable dairy rate by each daily balance on your acraunt.7hkd,weacidthe interest amount to the darlybalanm,andthesum will become thebeghnthgbalance forthe followkg day. )bur/merest charge forthe billing cycle Isthe sum ofthelmemstamountsthatwwere cnargedeach day during the blDngcyde foreach balancetype.We charge a minimum of$2 o/intemst In any brmngcYce fn whkf t you owe interest. Payinglnterest:Yurdue datekatleast 23 daysafterthe close ofeachbliiingcyde.We will not charge youanyinterest on purchases ffyou pay yourent/rebalance by the due dateeach month.We w9lbegincharginginterest on cash advarcesand balance transfers,ff appllcabk,on the transadkm date. Bankruptcy Notice:If you file bankruptcy you must send kis notice,Including account number and all Information related to the pnooeedmg to thefollowuVad*em GEMoneyBankAtbt:Bankruptcy Dept,RC1 Box 103106,Roswell,6430076. Your account lsownedandservieedbyGEMoneyBank. For complete terms and conditions ofyouraccount,eonsltyourOedrt Card ggmement. Hearing Impaired.•7DDeusersca81-877-448-8512 OIES302-8.06122/10 You and andntA f � �heiysRabout y Amouowoul like copy "y please us at the customertelephone numyou ber lndicatedonthefrontofthisstatement. 7hls is an attempt to coiled a debt and any Information obtained will be used for that purpose. �a abroviding a k1rhone numb�nd my account,I consent to GEMoney Bank and any other owner or servicer of my account g Y udengusingarrycorAadinformationorceflphonenumberslprovide,andlconsenttothe use of uaut a kphfmg temanediasystemanduoranartftklalormmcaapdvokewhen contacting me,even fflamdoargedforthe call undeFor changes of aaddress,phone number andor email,please check the box and print the changes below or visit us on-line at .wwwJemoneycom- Name ❑ street AaHres z o Fhonett 6mah1 H—roves enhes rnwnr aKp..nederne pwar RUJA*ft. A0�1� .can�mtomrcr you l�SS/CNR]RUS70PROWDEYOURBW ADDRESS D6 �R��REMLERACCO�NGYWRC4RD. SHERIFF'S OFFICE OF CUMBERLAND COUNTY Ronny R Anderson ED -OFF Sheriff LT THE PROTHONOTA. Jody S Smith Chief Deputy Richard W Stewart Solicitor oiciroutte, t'et 201 SEP —9 PH 3: 26 OFFiCE OF TPE $HS,R1FP CUMBERLAND COUNTY PENNSYLVANIA Portfolio Recovery Associates, LLC vs. Nicole Carney Case Number 2014-4948 SHERIFF'S RETURN OF SERVICE 08/28/2014 05:04 PM - Deputy Jason Kinsler, being duly sworn according to law, served the requested Complaint & Notice by "personally" handing a true copy to a person representing themselves to be the Defendant, to wit: Nicole Carney at 9 Grinnel Drive, Lower Allen, Camp Hill, PA 17011. JA N KINS ER, DEPUTY SHERIFF COST: $45.44 SO ANSWERS, August 29, 2014 RONNY R ANDERSON, SHERIFF (h) CountySuite Sheriff, Teleosoft, Carrie A. Brown, Esquire Robert N. Polas Jr, Esquire Mark R. Garvey, Esquire Gregory J. Babcock, Esquire Attorney ID # 94055/201259/312686/205061 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 Attorneys for Plaintiff IN THE COURT OF COMMON PLEAS OF CUMBERLAND COUNTY, PA CIVIL ACTION - LAW PORTFOLIO RECOVERY ASSOCIATES, LLC 120 CORPORATE BLVD NORFOLK, VA 23502 Plaintiff v. NICOLE CARNEY 9 GRINNEL DR CAMP HILL PA 17011 Defendant No. 14-4948 civil term PRAECIPE TO SETTLE DISCONTINUE AND END PLEASE MARK THE ABOVE -CAPTIONED ACTION AS SETTLED, DISCONTINUED AND ENDED. 14-50219 Res submitted, . Polas, Jr., Esquire PA Bar # 201259 Carrie Brown, Esquire PA Bar # 94055 Mark R. Garvey, Esquire PA Bar # 312686 Gregory J. Babcock, Esquire PA Bar # 205061 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 TELE: 1-866-428-8102 FAX: (757) 518-0860 Attorneys for Plaintiff This communication is from a debt collector and is an attempt to collect a debt. Any information obtained will be used for that purpose. or A. Brown, Esquire Robert N. Polas Jr, Esquire Mark R. Garvey, Esquire Gregory J. Babcock, Esquire Attorney ID # 94055/201259/312686/205061 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 Attorneys for Plaintiff IN THE COURT OF COMMON PLEAS OF CUMBERLAND COUNTY, PA CIVIL ACTION - LAW PORTFOLIO RECOVERY ASSOCIATES, LLC : 120 CORPORATE BLVD NORFOLK, VA 23502 Plaintiff : No. 14-4948 civil term v. NICOLE CARNEY 9 GRINNEL DR CAMP HILL PA 17011 Defendant CERTIFICATE OF SERVICE The undersigned does hereby certify that I served a copy of the foregoing Praecipe to Settle Discontinue and End upon NICOLE CARNEY by First Class Mail, Postage Pre -Paid, a copy thereof on thisday oe9C , 2014, to: 14-50219 NICOLE CARNEY 9 GRINNEL D HILL PA 17011 ert N. Polas, Jr., Esquire PA Bar # 201259 Carrie Brown, Esquire PA Bar # 94055 Mark R. Garvey, Esquire PA Bar # 312686 Gregory J. Babcock, Esquire PA Bar # 205061 Portfolio Recovery Associates, LLC 120 Corporate Blvd Norfolk, VA 23502 TELE: 1-866-428-8102 FAX: (757) 518-0860 Attorneys for Plaintiff This communication is from a debt collector and is an attempt to collect a debt. Anv information obtained will he used for this nnrnnse.